Robin Niblett awarded knighthood in Queen's Birthday Honours News release NCapeling 1 June 2022

Chatham House director Dr Robin Niblett CMG receives a knighthood for services to international relations and to British foreign policy.

Chatham House Council and staff congratulate the institute’s director Robin Niblett, who has been appointed as a Knight Commander of the Order of St Michael and St George (KCMG) by HM The Queen in her Birthday Honours list.

The citation for the KCMG, awarded at the recommendation of the UK foreign secretary, recognizes Dr Niblett’s ‘outstanding personal contribution to British soft power and influence in his role as director of Chatham House over the last 15 years’.

The citation also states: ‘With exceptional energy and talent, he has greatly enhanced the research reputation of the Institute, strengthened its international convening power, finances and staffing, and modernised its premises, image and diverse outreach’.

Dr Niblett is standing down in the summer and will be replaced by Bronwen Maddox, who joins from the Institute for Government.

Dr Niblett says: ‘I am deeply honoured by this award, which is as much a recognition of the tireless and selfless work of my colleagues at Chatham House throughout my tenure as director.

‘Together, and through challenging times, we have offered a vital source of independent debate and analysis. And, with the engagement of our supporters and a new generation of thinkers and actors, I know the institute will continue to provide creative ideas for a better future.’

Independent Thinking: Iran protests, Iraq's invasion legacy Audio NCapeling 17 November 2022

Episode five of our new weekly podcast has a Middle East focus with insights into what is driving the ongoing protests in Iran, and the progress of Iraq in the years since the fall of Saddam Hussein.

Since September, Iran has been swept by thousands of women-led protests, demanding an end to the morality police and the even calling for the fall of the Islamic Republic.

Meanwhile at Chatham House this week saw our Iraq Initiative conference 2022, which delved heavily into the multiple challenges facing Iraq two decades on from the invasion which toppled Saddam Hussein.

Joining Bronwen Maddox on the podcast this week are the Chatham House Middle East and North Africa programme deputy director Dr Sanam Vakil and senior research fellow Dr Renad Mansour, who is also project director of the Iraq Initiative. They are joined by Sanya Burgess, digital investigations journalist with Sky News.

Independent Thinking: Nigeria votes, Northern Ireland deal Audio NCapeling 2 March 2023

Episode 17 of our weekly podcast examines the outcome of Nigeria’s presidential election and the new deal for Northern Ireland negotiated by the UK and EU.

On 24 February, millions of Nigerians went to the polls in an election widely seen as crucial for the direction of the country, with the winner Bola Ahmed Tinubu declared the new president-elect. The panel discusses the state of Nigeria’s democracy and what lies ahead for the new administration.

In addition, UK prime minister Rishi Sunak and European Commission president Ursula von der Leyen announced a new deal for Northern Ireland with implications for all the UK. Three years after the UK formally left the European Union (EU), has Rishi Sunak now got Brexit done?

Joining Bronwen Maddox are Leena Koni Hoffman, associate fellow with the Chatham House Africa programme, Aanu Adeoye, West African correspondent for the Financial Times and an academy associate at Chatham House, and Charles Grant, director of the Centre for European Reform.

About Independent Thinking

A weekly podcast hosted by Chatham House director Bronwen Maddox, in conversation with leading policymakers, journalists, and Chatham House experts providing insight on the latest international issues.

Independent Thinking: Consequences of the Iraq war Audio NCapeling 23 March 2023

Episode 20 of our weekly podcast marks 20 years since the invasion of Iraq, with special guest Clare Short who resigned from the UK government over the issue.

Launched amid fears that Saddam Hussein was acquiring weapons of mass destruction, the Iraq war changed the Middle East and inflicted huge damage with effects that persist today.

This week’s panel examines the war from the perspective of those in power in London when the decision was made to commit UK forces to the invasion, and with those in Iraq who lived with the consequences.   

Joining Bronwen Maddox is special guest Clare Short, former Secretary of State for International Development, who served in the UK cabinet and resigned after the invasion began, becoming one of the best-known critics of prime minister Tony Blair’s approach to the war.

On the panel from Chatham House is Dr Patricia Lewis, director of the International Security programme, and three members of the Middle East and North Africa programme; the director Dr Lina Khatib, senior research fellow Dr Renad Mansour who is also project director of the Iraq Initiative, and research associate Hayder Al-Shakeri.

About Independent Thinking

A weekly podcast hosted by Chatham House director Bronwen Maddox, in conversation with leading policymakers, journalists, and Chatham House experts providing insight on the latest international issues.

Evolving Turkey–Iran relations and implications for regional reordering

This project examines the nature of the bilateral relationship between Turkey and Iran in relation to Middle Eastern countries and in the context of broader regional dynamics.

The 2016–21 period in Turkish–Iranian relations, which was marked by both sides’ structured cooperation through the Astana Process and Sochi summits on conflict management in Syria, and their largely shared opposition to US policy in Syria and at the broader regional level, to Iraqi Kurdistan’s independence referendum, and to the blockade of Qatar, has run its course. 

However, the new shape of these bilateral relations remains undefined, and understanding them is essential to effective policymaking in the region. How they will evolve will have direct ramifications for Iraq, Syria, regional Kurdish geopolitics, and the process of regional reordering and connectivity in the Middle East and South Caucasus. They will also have direct implications for US and European policymaking and role in the region. 

This project studies the evolving nature of Turkish–Iranian relations through Iraq, Syria and regional Kurdish politics. It examines how Turkey and Iran approach regional connectivity projects and major regional initiatives, and how ongoing regional developments, including the war in Gaza, have and may impact Turkey–Iran relations and EU, US and UK security considerations and policy towards the two countries.

The Centre for Applied Turkey Studies (CATS) at the Stiftung Wissenschaft und Politik (SWP) in Berlin is funded by Stiftung Mercator and the Federal Foreign Office. CATS is the curator of the CATS Network, an international network of think-tanks and research institutions working on Turkey. 

Evolving Turkey–Iran Relations and Implications for Regional Reordering is a project of the CATS Network.

RK Tangirala
Nov 1, 1995; 36:2320-2328
Articles

G Lepage
Jan 1, 1986; 27:114-120
Articles

Chatham House appoints Tim Benton as Research Director for Energy, Environment and Resources News Release sysadmin 30 May 2019

Chatham House is pleased to announce that Professor Tim Benton has been appointed as research director of the Energy, Environment and Resources Department.

Sir David Attenborough and the BBC Studios Natural History Unit awarded Chatham House Prize 2019 for ocean advocacy News Release sysadmin 18 November 2019

The 2019 Chatham House Prize is awarded to Sir David Attenborough and Julian Hector, head of BBC Studios Natural History Unit, for the galvanizing impact of the Blue Planet II series on tackling ocean plastic pollution.

Renata Dwan Joins as Deputy Director and Senior Executive Officer News Release sysadmin 19 August 2020

Renata Dwan has been appointed deputy director and senior executive officer of Chatham House.

Mammalian circadian clocks are driven by transcription/translation feedback loops composed of positive transcriptional activators (BMAL1 and CLOCK) and negative repressors (CRYPTOCHROMEs (CRYs) and PERIODs (PERs)). CRYs, in complex with PERs, bind to the BMAL1/CLOCK complex and repress E-box–driven transcription of clock-associated genes. There are two individual CRYs, with CRY1 exhibiting higher affinity to the BMAL1/CLOCK complex than CRY2. It is known that this differential binding is regulated by a dynamic serine-rich loop adjacent to the secondary pocket of both CRYs, but the underlying features controlling loop dynamics are not known. Here we report that allosteric regulation of the serine-rich loop is mediated by Arg-293 of CRY1, identified as a rare CRY1 SNP in the Ensembl and 1000 Genomes databases. The p.Arg293His CRY1 variant caused a shortened circadian period in a Cry1−/−Cry2−/− double knockout mouse embryonic fibroblast cell line. Moreover, the variant displayed reduced repressor activity on BMAL1/CLOCK driven transcription, which is explained by reduced affinity to BMAL1/CLOCK in the absence of PER2 compared with CRY1. Molecular dynamics simulations revealed that the p.Arg293His CRY1 variant altered a communication pathway between Arg-293 and the serine loop by reducing its dynamicity. Collectively, this study provides direct evidence that allosterism in CRY1 is critical for the regulation of circadian rhythm.

Zika virus (ZIKV) is a neurotropic flavivirus that causes several diseases including birth defects such as microcephaly. Intrinsic immunity is known to be a frontline defense against viruses through host anti-viral restriction factors. Limited knowledge is available on intrinsic immunity against ZIKV in brains. Amyloid precursor protein (APP) is predominantly expressed in brains and implicated in the pathogenesis of Alzheimer's diseases. We have found that ZIKV interacts with APP, and viral infection increases APP expression via enhancing protein stability. Moreover, we identified the viral peptide, HGSQHSGMIVNDTGHETDENRAKVEITPNSPRAEATLGGFGSLGL, which is capable of en-hancing APP expression. We observed that aging brain tissues with APP had protective effects on ZIKV infection by reducing the availability of the viruses. Also, knockdown of APP expression or blocking ZIKV-APP interactions enhanced ZIKV replication in human neural progenitor/stem cells. Finally, intracranial infection of ZIKV in APP-null neonatal mice resulted in higher mortality and viral yields. Taken together, these findings suggest that APP is a restriction factor that protects against ZIKV by serving as a decoy receptor, and plays a protective role in ZIKV-mediated brain injuries.

Evolving evidence suggests that nicotine may contribute to impaired asthma control by stimulating expression of nerve growth factor (NGF), a neurotrophin associated with airway remodeling and airway hyperresponsiveness. We explored the hypothesis that nicotine increases NGF by reducing lung fibroblast (LF) microRNA-98 (miR-98) and PPARγ levels, thus promoting airway remodeling. Levels of NGF, miR-98, PPARγ, fibronectin 1 (FN1), endothelin-1 (EDN1, herein referred to as ET-1), and collagen (COL1A1 and COL3A1) were measured in human LFs isolated from smoking donors, in mouse primary LFs exposed to nicotine (50 μg/ml), and in whole lung homogenates from mice chronically exposed to nicotine (100 μg/ml) in the drinking water. In selected studies, these pathways were manipulated in LFs with miR-98 inhibitor (anti-miR-98), miR-98 overexpression (miR-98 mimic), or the PPARγ agonist rosiglitazone. Compared with unexposed controls, nicotine increased NGF, FN1, ET-1, COL1A1, and COL3A1 expression in human and mouse LFs and mouse lung homogenates. In contrast, nicotine reduced miR-98 levels in LFs in vitro and in lung homogenates in vivo. Treatment with anti-miR-98 alone was sufficient to recapitulate increases in NGF, FN1, and ET-1, whereas treatment with a miR-98 mimic significantly suppressed luciferase expression in cells transfected with a luciferase reporter linked to the putative seed sequence in the NGF 3'UTR and also abrogated nicotine-induced increases in NGF, FN1, and ET-1 in LFs. Similarly, rosiglitazone increased miR-98 and reversed nicotine-induced increases in NGF, FN1, and ET-1. Taken together, these findings demonstrate that nicotine-induced increases in NGF and other markers of airway remodeling are negatively regulated by miR-98.

Expert

Expert

Expert